PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NAC
Protein Properties Length: 298aa    MW: 33756.7 Da    PI: 8.7605
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626600.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.33.2e-49141391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF Ptdeel+veyL++k++g++++l + i+e+d+yk++ w Lp+k+  +ek+wyfFs+rd+ky++g+r+nr + sgyWkatg+dk++ + 
  XP_013626600.1  14 LPPGFRFYPTDEELMVEYLCRKAAGHDFSL-QLIAEIDLYKFDAWVLPSKALFGEKDWYFFSPRDRKYPNGSRPNRCAGSGYWKATGTDKAIST- 106
                     79***************************9.89***************8777899**************************************9. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  XP_013626600.1 107 EGRRVGVKKALVFYVGKAPKGTKTNWIMHEYRL 139
                     9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-6410162IPR003441NAC domain
PROSITE profilePS5100557.78414162IPR003441NAC domain
PfamPF023651.8E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGIQERDPLT QLSLPPGFRF YPTDEELMVE YLCRKAAGHD FSLQLIAEID LYKFDAWVLP  60
SKALFGEKDW YFFSPRDRKY PNGSRPNRCA GSGYWKATGT DKAISTEGRR VGVKKALVFY  120
VGKAPKGTKT NWIMHEYRLI EPSRRNGSTK LDDWVLCRIY KKQSSAQKDD YNSNLMTREY  180
SHNGSSTSYS SHQYDDVFED KTGFLNLARE PSFDWVNSTG HNSVPELGLR HNVPCLRYGG  240
GYLHGVKTSG EGNKTHEQAE VIPRFNNSGV LSYDQGSSVD PVNGFGHSGQ QPSRFGFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11711684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-11711684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-11711684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-11711684171NO APICAL MERISTEM PROTEIN
3swm_A1e-11711687174NAC domain-containing protein 19
3swm_B1e-11711687174NAC domain-containing protein 19
3swm_C1e-11711687174NAC domain-containing protein 19
3swm_D1e-11711687174NAC domain-containing protein 19
3swp_A1e-11711687174NAC domain-containing protein 19
3swp_B1e-11711687174NAC domain-containing protein 19
3swp_C1e-11711687174NAC domain-containing protein 19
3swp_D1e-11711687174NAC domain-containing protein 19
4dul_A1e-11711684171NAC domain-containing protein 19
4dul_B1e-11711684171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6701211e-176KJ670121.1 Brassica napus NAC transcription factor 55-1 (NAC55-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626600.10.0PREDICTED: NAC domain-containing protein 55-like
SwissprotQ9LDY81e-164NAC55_ARATH; NAC domain-containing protein 55
TrEMBLA0A0D3BBH30.0A0A0D3BBH3_BRAOL; Uncharacterized protein
STRINGBra001596.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.11e-162NAC domain containing protein 3